W1siziisijiwmjavmtivmtgvmtqvndcvmdgvytrimwnmzgmtogzmms00zmrhltgyztctmjfkowixmze1oty1l0feie9yz2fuawmgu2vhcmnoie1hcmtldgluzy5qcgcixsxbinailcj0ahvtyiisijiwmdb4odawiyjdxq

Organic Search Marketing

Icon for this discipline. To be used on the homepage and other pages

Blank

Organic Search Marketing

The growth opportunities provided by content and technology-driven organic search marketing is immense. That is why SEO is a quickly evolving online marketing discipline and offers a variety of tools and a good ROI.

We keep pace with the market and are constantly in contact with candidates who create and implement creative and innovative organic search strategies. Reach out if you want to learn more about SEO talent for your market.

  • W1siziisijiwmjavmtivmdqvmtqvndavmjavotmxl2jhy2tncm91bmrib3hlc192ms5qcgcixsxbinailcj0ahvtyiisijywmhgyntbcdtawm2mixv0

    Technical SEO

    Content: We work with SEO experts with strong technical background who understand the importance of a variety of technical website parameters. They understand the nature of the web ecosystem and know ways of optimizating the following aspects:


    • Crawling
    • Rendering
    • Indexation
    • Mobile SEO
    • Page speed
    • (Domain) Migrations

    and more...

  • W1siziisijiwmjavmtivmdqvmtqvndavmjyvmjk5l2jhy2tncm91bmrib3hlc192ms5qcgcixsxbinailcj0ahvtyiisijywmhgyntbcdtawm2mixv0

    On-Page SEO

    Our candidates have good understanding of front-end development (HTML, CSS, JavaScript) and search engine algorithms which allow them to be successful at:


    • Content Marketing
    • Site Architecture including URL-structuring
    • TAG and Meta descriptions
    • Keyword optimisations

    and more…

  • W1siziisijiwmjavmtivmdqvmtqvndavmzevndqzl2jhy2tncm91bmrib3hlc192ms5qcgcixsxbinailcj0ahvtyiisijywmhgyntbcdtawm2mixv0

    Off-Page SEO

    If you want to drive significant organic traffic to your website then you need to remember about effective off-page SEO on top of your technical and on-page SEO strategy. Only a strong combination of all 3 components will allow you achieve the desired search ranking. Successful off-page SEO combines of:


    • Link Building
    • Backlink source analysis
    • Social media link marketing

    and more…

  • W1siziisijiwmjavmtivmdqvmtqvndavmzyvntezl2jhy2tncm91bmrib3hlc192ms5qcgcixsxbinailcj0ahvtyiisijywmhgyntbcdtawm2mixv0

    SEO Tools

    SEO Experts have the ability to work with a variety of SEO Tools. Using modern technology enables automated website, market and competition analysis. Our candidates have expert knowledge in open source and premium SEO tools:


    • Google Analytics & Search console
    • MOZ
    • SEMrush
    • Ahrefs
    • Searchmetrix
    • Sistrix

    and many more…